26 Comments

Despicable. Who the hell does the CDC actually work for. It sure as a clot shot is not the American people or their health.

Expand full comment

Fauci has full control of CDC/FDA going back to when Trump was in office and Trump's own Health Secretary bowed to Fauci.

As Dr. McCullough said from the beginning, the CDC has always been a stake holder in promoting the vaccines (see Dr David Martin, PhD), and the FDA is owned by Big Pharma and Fauci.

Expand full comment
Comment deleted
Expand full comment

You are correct. Fauci has been under several investigations starting in the 80's, to include laundering money, and somehow skates. He is being held up by very influential and powerful people. I have my suspicions of who they are, but no concrete evidence. Fauci is pure evil.

Expand full comment

Thank God for good people like Ron Johnson and you, Dr. Alexander, working tirelessly on our behalf to pull back the curtains and get at the truth. I know it's not easy to stand alone against the crowd. But every person in power who speaks up and takes action like this may inspire others who have been silent to do the same.

Expand full comment

please consider donating to his re-election campaign, we need him!!!

Expand full comment

Paul: The way to get attention is to get the politicians to start making definitive claims like:

"This is the biggest scandal in human history", " Fauci is Dr. Death",

"We need to begin Nurenburg 2.0)",

"The Gene Therapy experiment has been a failure & has negative benefit vs the mild Omicron", "Only Natural Immunity has ended the Pandemic, independent of full Jabs, as well as boosters"

"Fauci, the FDA/CDC and the Democrats have crushed Early Treatment, which always worked",

"Social Media, Pfizer, Moderna, the CDC/FDA/WHO, Dems, MSM have all been messengers of Misinformation"

Dems are always united in their message. Its time for the "good guys" who have the truth, to start being united. It would take the pressure off of people like Sen. Johnson and also force the biased MSM to repeat those quotes and ask WHY. As bad as the MSM has become, they will repeat shocking headlines.

That Repubs haven't done this in the past or present, is reason to suspect influence by Big Pharma on Trump and others.

Paul, good to see you are back on Twitter. Was Canada blocking your Twitter.

Check out my Tweets (to you) where I show that NYS/Brooklyn has enough enough Omicron to validate Natural Population Immunity (herd) and that there is no correlation with Booster numbers.

You should also check out Booster levels for Chile & Denmark - not just Ireland.

Jerry W.

Expand full comment

Unbelievable. These people are shameless.

Expand full comment

Looks like the cdc is in hot water. Why else would Rochelle ignore Senator Johnson’s requests for transparency. Not looking too god for the director of the cdc. Are her days numbered at the helm of this broken government department?

Expand full comment

I smell too many RATS!!!

Expand full comment

CDC silence is anything but golden.

Expand full comment

Dr. Loren D. Walensky, husband from the CDC director, has huge amounts of patents, among others one from 2016 titled: "Compositions and methods for the treatment of viral infections”.

2 amino acid strings from it have 98% and 87% IDENTICAL pieces which are in the SARS-CoV-2 spike protein. That Spike gene from all injections will encode those pieces. Here the BLAST comparison of what is ending in human bodies AFTER the injections and what Dr. Walensky is collecting cash for:

Query 1 TSPDVDFGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY 47

____________TSPDVD_GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY

Sbjct 1160 TSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKY 1206

and similar identities are for the second patented piece: 'NVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE'.

Walensky's patent states: “Coronavirus alpha helix heptad repeat domains are known in the art and include those which have an amino acid sequence which are 30% or more identical to.."

those sequences.

The 2020 Spike is 98% with what he patented in 2016! Just wonder, will he get his share for all those identical pieces?? If so, a clever way to provide for his family!!!

Expand full comment

Good research! So the question is, IS he $ benefitting? If so, it would be an extraordinary revelation.

Expand full comment

That would be a question for a patent specialist, like Dr. David Martin for example.

I just analyze the scientific data inside of the patentable entities.. This trend though, to start with a tiny patented piece, then adding to it one element after another is everywhere inside of patentable proteins, genes, i.e biological matter. I wrote a small article about it in my newsletter, it's title: "Sars-Cov-2 Spike bioinformatics. Part 2."

Please check it out if you have time.

Expand full comment

There need to be an awakening, and fast, that the globalist Massvaxists are going to promote a world war. This will achieve their goal of population control and decline that they were not able to achieve with COVID. The fraud we call president is supercharging the effort of Obama to reduce the USAs position as the leading superpower. Trump created a 4-year pause in national suicide but we have been put back on that course in an even faster vehicle that is accelerating each day The military’s morale is in no condition, due to service member purging and gene transfer therapy mandate side effects, to engage with the Russians. Add to that that the fraud in the White House fails in every category of strong leadership that you must have when considering entering a hot war with a formidable enemy. We are paying the price of the 2020 election fraud and the globalists who benefited from that fraud are setting up conditions to assure their power cannot be elected away. The alarm clock has been going off but all the country does is continually hit the snooze button.

Expand full comment

Unelected bureaucrats, evil too. Ignore requests because they can. Bercerra is evil as well. He is from CA and has no medical background, not an MD.

Expand full comment

If this were any of the average citizens that pay the bills for this theater, we'd be in handcuffs.

Expand full comment

Hopefully he continues to be a thorn in their side until the truth comes out. So evil what is going on. Very thankful for those trying to get the truth out.

Expand full comment

My new chant? "CDC-Free by 2023!!"

I live in Atlanta, and wish the truck convoy came here before DC (CDC is in ATL). Why are there not more CDC whistle-blowers?

Expand full comment

The CDC and NIH personnel simply stonewall inside their secure bunkers/campus.

Expand full comment

The failure of the CDC to respond to Sen. Johnson is repugnant in a free society. If that is the response a senator gets where does a citizen stand? Are we to kneel as subjects? And where are the senators who should be standing with Sen. Johnson? Are they kneeling before the altar of fear and corruption?

Thank you to everyone who speaks up. Speak up more. Advocate for justice.

Expand full comment

Great letter from Johnson.

Expand full comment